PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.23794s0877.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 754aa    MW: 83017.7 Da    PI: 5.8505
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.23794s0877.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.71.9e-1895150156
                           TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                           +++  ++++ q++e+e++F+++++p+ ++r+eL+++lgL+  q+k+WFqN+R++ k
  Bostr.23794s0877.1.p  95 KKRYNRHSQFQIQEMEAFFRECPHPDDKQRKELSRQLGLDPIQIKFWFQNKRTQNK 150
                           5677889**********************************************998 PP

2START176.71.4e-552815012206
                           HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.... CS
                 START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla.... 77 
                           la  a++el+++a+++ep+W+  +      +n de++ +f ++ +     +++ea+r++++v m+++  ++ l++ +  W++++     
  Bostr.23794s0877.1.p 281 LAVGAMEELMLMAQVGEPLWMGGVngtsLALNLDEYTGTFRKGLGprlsgFRTEASRETALVAMNPTGILQMLMQEN-LWSTMFVgmig 368
                           78899****************9999987889*********88776********************************.*********** PP

                           EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECT CS
                 START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksn 159
                           ka+t+e+is +      galq m+ae+q+lsplv+ R+++fvRy++q+g+g w++vdvS+d+  ++       +++++pSg+li++ + 
  Bostr.23794s0877.1.p 369 KAMTHEQISADvagnfnGALQIMSAEYQVLSPLVStRESYFVRYCKQQGDGLWAVVDVSIDHLLPNIH----LKCRRRPSGCLIQEIPS 453
                           *****************************************************************985....99999************ PP

                           CEEEEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                 START 160 ghskvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                           g+skvtwvehv++++r   h+++++l+ +g+a+ga++wvatl+rqce+
  Bostr.23794s0877.1.p 454 GYSKVTWVEHVEVDDREGvHNIFKHLICTGQAFGANRWVATLERQCER 501
                           ***************9877***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.7E-2072150IPR009057Homeodomain-like
SuperFamilySSF466892.88E-1887156IPR009057Homeodomain-like
PROSITE profilePS5007116.43992152IPR001356Homeobox domain
SMARTSM003893.7E-1793156IPR001356Homeobox domain
CDDcd000862.11E-1894153No hitNo description
PfamPF000465.5E-1695150IPR001356Homeobox domain
PROSITE patternPS000270127150IPR017970Homeobox, conserved site
PROSITE profilePS5084838.031271504IPR002913START domain
SuperFamilySSF559612.75E-30272503No hitNo description
CDDcd088757.25E-116275500No hitNo description
SMARTSM002341.7E-47280501IPR002913START domain
PfamPF018526.6E-47281501IPR002913START domain
Gene3DG3DSA:3.30.530.204.6E-6376465IPR023393START-like domain
SuperFamilySSF559614.65E-15524717No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048825Biological Processcotyledon development
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 754 aa     Download sequence    Send to blast
MSEPNMVPVD NNGDNNNKEN NNMNNTNGGI NNTNGGINNT NGRADVGADV GAEEHDSANT  60
LSDNHEETFG NNHEEALGNN HEEALGDNED PPRKKKRYNR HSQFQIQEME AFFRECPHPD  120
DKQRKELSRQ LGLDPIQIKF WFQNKRTQNK NHQERFENTE LRTVNNKLRA ENQRYREAIL  180
QALCPKCGGQ TAIGDMSFEE HHLRIQNARL NEEINQLSAL AARFTRKPVM SYPVMSPPIN  240
RRQPLEFGVG SIGRDLYGNG GNLSREITGP ADADKPMIIE LAVGAMEELM LMAQVGEPLW  300
MGGVNGTSLA LNLDEYTGTF RKGLGPRLSG FRTEASRETA LVAMNPTGIL QMLMQENLWS  360
TMFVGMIGKA MTHEQISADV AGNFNGALQI MSAEYQVLSP LVSTRESYFV RYCKQQGDGL  420
WAVVDVSIDH LLPNIHLKCR RRPSGCLIQE IPSGYSKVTW VEHVEVDDRE GVHNIFKHLI  480
CTGQAFGANR WVATLERQCE RIASIIATDF ESVDSGDHIT LTNHGKMSIL KLAERIARSF  540
FVGLTNSMGS TFSGGAGDDI RVMTMKSLND PGRPPGVILS AATSFWVPVP PKTVFDFLRD  600
ENHRTKWDVL CTGGIVQKIS EIANGRDSRN CATLLRNANN CQSKMMIVQE TSTDPTASFV  660
IYAPVDTASI EAVLNAGGDP DYVALLPSGF AILPDGMGQP GENGGGSLLT VAFQMLVETA  720
PLGKLSISSV ATVENLIRTT VLRIKALFPS QTV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010417818.10.0PREDICTED: homeobox-leucine zipper protein HDG3-like
SwissprotQ9ZV650.0HDG3_ARATH; Homeobox-leucine zipper protein HDG3
TrEMBLR0HIB70.0R0HIB7_9BRAS; Uncharacterized protein
STRINGAT2G32370.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49128149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32370.10.0homeodomain GLABROUS 3